PDB entry 1sk3

View 1sk3 on RCSB PDB site
Description: Crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha
Deposited on 2004-03-04, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sk3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sk3A (A:)
    vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
    fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
    liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh