PDB entry 1sk3

View 1sk3 on RCSB PDB site
Description: Crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha
Class: immune system
Keywords: alpha/beta mix, IMMUNE SYSTEM
Deposited on 2004-03-04, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein I-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PGRPIA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sk3a_
  • Heterogens: NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sk3A (A:)
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh