PDB entry 1sjy

View 1sjy on RCSB PDB site
Description: Crystal Structure of NUDIX HYDROLASE DR1025 FROM DEINOCOCCUS RADIODURANS
Class: hydrolase
Keywords: NUDIX FOLD, alpha-beta-alpha sandwich, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2004-03-04, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.228
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sjya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjyA (A:)
    mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
    aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
    fvsredfaqlyaagqirmyqtklfyadalrekgfpalpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjyA (A:)
    ehderthvpvelraagvvllnergdillvqekgiekaglwhipsgavedgenpqdaavre
    aceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvsre
    dfaqlyaagqirmyqtklfyadalrekgfpalpv