PDB entry 1sjw

View 1sjw on RCSB PDB site
Description: Structure of polyketide cyclase SnoaL
Class: lyase
Keywords: Anthracyclines, Nogalamycin, SnoaL, aldol condensation, LYASE, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2004-03-04, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nogalonic acid methyl ester cyclase
    Species: Streptomyces nogalater [TaxId:38314]
    Gene: SnoaL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RN59 (10-End)
      • see remark 999 (1-9)
    Domains in SCOPe 2.07: d1sjwa_
  • Heterogens: NGV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjwA (A:)
    msrqteivrrmvsafntgrtddvdeyihpdylnpatlehgihtgpkafaqlvgwvratfs
    eearleevrieergpwvkaylvlygrhvgrlvgmpptdrrfsgeqvhlmrivdgkirdhr
    dwpdfqgtlrqlgdpwpddegwrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjwA (A:)
    srqteivrrmvsafntgrtddvdeyihpdylnpatlehgihtgpkafaqlvgwvratfse
    earleevrieergpwvkaylvlygrhvgrlvgmpptdrrfsgeqvhlmrivdgkirdhrd
    wpdfqgtlrqlgdpwpddegwr