PDB entry 1sju

View 1sju on RCSB PDB site
Description: mini-proinsulin, single chain insulin analog mutant: des b30, his(b 10)asp, pro(b 28)asp and peptide bond between lys b 29 and gly a 1, nmr, 20 structures
Class: hormone
Keywords: hormone, glucose metabolism, signal, disease mutation, diabetes
Deposited on 1997-10-09, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proinsulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-49)
      • engineered (9)
      • engineered (27)
    Domains in SCOPe 2.07: d1sjua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjuA (A:)
    fvnqhlcgsdlvealylvcgergffytdkgiveqcctsicslyqlenycn