PDB entry 1sju

View 1sju on RCSB PDB site
Description: mini-proinsulin, single chain insulin analog mutant: des b30, his(b 10)asp, pro(b 28)asp and peptide bond between lys b 29 and gly a 1, nmr, 20 structures
Deposited on 1997-10-09, released 1998-03-18
The last revision prior to the SCOP 1.57 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -2.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1sju__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sju_ (-)
    fvnqhlcgsdlvealylvcgergffytdkgiveqcctsicslyqlenycn