PDB entry 1sjs

View 1sjs on RCSB PDB site
Description: access to phosphorylation in isocitrate dehydrogenase may occur by domain shifting
Class: oxidoreductase
Keywords: I oxidoreductase, nad(a) - choh(d), phosphorylation, oxidoreductase
Deposited on 1997-07-08, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sjsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjsA (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjsA (A:)
    eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
    kiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqe
    ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
    emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegaf
    kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
    mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
    mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm