PDB entry 1sjr

View 1sjr on RCSB PDB site
Description: NMR Structure of RRM2 from Human Polypyrimidine Tract Binding Protein Isoform 1 (PTB1)
Class: RNA binding protein
Keywords: extended BABBAB motif, RNA BINDING PROTEIN
Deposited on 2004-03-04, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polypyrimidine tract-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTBP1, PTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sjra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjrA (A:)
    mhhhhhhgsaqaalqavnsvqsgnlalaasaaavdagmamagqspvlriivenlfypvtl
    dvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhaklsldgqniynacctlridf
    skltslnvkynndksrdytrpdlpsgdsqpsldqtmaaafglsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjrA (A:)
    magqspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqh
    aklsldgqniynacctlridfskltslnvkynndksrdytrpdlpsgd