PDB entry 1sjq

View 1sjq on RCSB PDB site
Description: nmr structure of rrm1 from human polypyrimidine tract binding protein isoform 1 (ptb1)
Deposited on 2004-03-04, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sjqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1sjqA (A:)
mrgshhhhhhgsgvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemn
teeaantmvnyytsvtpvlrgqpiyiqfsnhkelktdsspnqara

    Sequence, based on observed residues (ATOM records): (download) 
    >1sjqA (A:)
sgvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaantmvny
ytsvtpvlrgqpiyiqfsnhkelktdss