PDB entry 1sjj

View 1sjj on RCSB PDB site
Description: Cryo-EM Structure of Chicken Gizzard Smooth Muscle alpha-Actinin
Class: contractile protein
Keywords: 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, CONTRACTILE PROTEIN
Deposited on 2004-03-03, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 20 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actinin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sjja_
  • Chain 'B':
    Compound: actinin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sjjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjjA (A:)
    ldpawekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergk
    mrvhkisnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisveet
    sakeglllwyqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltn
    lntafdvaekyldipkmldaedivgtarpdekaimtyvssfyhafsgaqkaetaanrick
    vlavnqeneqlmedyeklasdllewirrtipwlenrapentmqamqqkledfrdyrrlhk
    ppkvqekcqleinfntlqtklrlsnrpafmpsegkmvsdinnawggleqaekgyeewlln
    eirrlerldhlaekfrqkasiheswtdgkeamlqqkdyetatlseikallkkheafesdl
    aahqdrveqiaaiaqelneldyydspsvnarcqkicdqwdnlgaltqkrrealertekll
    etidqlyleyakraapfnnwmegamedlqdtfivhtieeiqglttaheqfkatlpdadke
    rqailgihnevskivqtyhvnmagtnpyttitpqeingkwehvrqlvprrdqalmeehar
    qqqnerlrkqfgaqanvigpwiqtkmeeigrisiemhgtledqlnhlrqyeksivnykpk
    idqlegdhqqiqealifdnkhtnytmehirvgweqllttiartinevenqiltrdakgis
    qeqmnefrasfnhfdrkktgmmdcedfraclismgynmgeaefarimsivdpnrmgvvtf
    qafidfmsretadtdtadqvmasfkilagdknyitvdelrrelppdqaeyciarmapyng
    rdavpgaldymsfstalygesdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjjB (B:)
    ldpawekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergk
    mrvhkisnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisveet
    sakeglllwyqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltn
    lntafdvaekyldipkmldaedivgtarpdekaimtyvssfyhafsgaqkaetaanrick
    vlavnqeneqlmedyeklasdllewirrtipwlenrapentmqamqqkledfrdyrrlhk
    ppkvqekcqleinfntlqtklrlsnrpafmpsegkmvsdinnawggleqaekgyeewlln
    eirrlerldhlaekfrqkasiheswtdgkeamlqqkdyetatlseikallkkheafesdl
    aahqdrveqiaaiaqelneldyydspsvnarcqkicdqwdnlgaltqkrrealertekll
    etidqlyleyakraapfnnwmegamedlqdtfivhtieeiqglttaheqfkatlpdadke
    rqailgihnevskivqtyhvnmagtnpyttitpqeingkwehvrqlvprrdqalmeehar
    qqqnerlrkqfgaqanvigpwiqtkmeeigrisiemhgtledqlnhlrqyeksivnykpk
    idqlegdhqqiqealifdnkhtnytmehirvgweqllttiartinevenqiltrdakgis
    qeqmnefrasfnhfdrkktgmmdcedfraclismgynmgeaefarimsivdpnrmgvvtf
    qafidfmsretadtdtadqvmasfkilagdknyitvdelrrelppdqaeyciarmapyng
    rdavpgaldymsfstalygesdl