PDB entry 1sji

View 1sji on RCSB PDB site
Description: Comparing skeletal and cardiac calsequestrin structures and their calcium binding: a proposed mechanism for coupled calcium binding and protein polymerization
Class: metal binding protein
Keywords: calsequestrin, Glycoprotein, Calcium-binding, Muscle protein, METAL BINDING PROTEIN
Deposited on 2004-03-03, released 2005-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calsequestrin, cardiac muscle isoform
    Species: Canis lupus [TaxId:9615]
    Gene: CASQ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sjia1, d1sjia2, d1sjia3
  • Chain 'B':
    Compound: Calsequestrin, cardiac muscle isoform
    Species: Canis lupus [TaxId:9615]
    Gene: CASQ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sjib1, d1sjib2, d1sjib3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjiA (A:)
    glnfptydgkdrvvslteknfkqvlkkydvlclyyhesvssdkvaqkqfqlkeivlelva
    qvlehkdigfvmvdakkeaklakklgfdeegslyvlkgdrtiefdgefaadvlveflldl
    iedpveiinsklevqaferiedqikligffkseeseyykafeeaaehfqpyikffatfdk
    gvakklslkmnevdfyepfmdepiaipdkpyteeelvefvkehqrptlrrlrpedmfetw
    eddlngihivafaersdpdgyefleilkqvardntdnpdlsivwidpddfpllvaywekt
    fkidlfkpqigvvnvtdadsvwmeipddddlptaeeledwiedvlsgkin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjiB (B:)
    glnfptydgkdrvvslteknfkqvlkkydvlclyyhesvssdkvaqkqfqlkeivlelva
    qvlehkdigfvmvdakkeaklakklgfdeegslyvlkgdrtiefdgefaadvlveflldl
    iedpveiinsklevqaferiedqikligffkseeseyykafeeaaehfqpyikffatfdk
    gvakklslkmnevdfyepfmdepiaipdkpyteeelvefvkehqrptlrrlrpedmfetw
    eddlngihivafaersdpdgyefleilkqvardntdnpdlsivwidpddfpllvaywekt
    fkidlfkpqigvvnvtdadsvwmeipddddlptaeeledwiedvlsgkin