PDB entry 1sjh

View 1sjh on RCSB PDB site
Description: HLA-DR1 complexed with a 13 residue HIV capsid peptide
Class: immune system
Keywords: MHC class II, Major histocompatibility protein complex, HLA-DR1, HIV-1, capsid, superantigen, antigen, gag, IMMUNE SYSTEM
Deposited on 2004-03-03, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sjha1, d1sjha2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sjhb1, d1sjhb2
  • Chain 'C':
    Compound: gag polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ENTC3, SAV2009, SA1817
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (0-238)
      • engineered (42)
      • engineered (44-46)
    Domains in SCOPe 2.07: d1sjhd1, d1sjhd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjhA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjhA (A:)
    ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
    avdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwlr
    ngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjhB (B:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvs
    gfypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sjhD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjhD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegnhfdngnlq
    nvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyikfi
    enngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng