PDB entry 1sj5

View 1sj5 on RCSB PDB site
Description: Crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2004-03-02, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TM0160
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0160
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY07 (12-156)
      • cloning artifact (11)
      • engineered (49)
      • see remark 999 (157-161)
    Domains in SCOPe 2.07: d1sj5a1, d1sj5a2
  • Chain 'B':
    Compound: conserved hypothetical protein TM0160
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0160
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY07 (12-End)
      • cloning artifact (11)
      • engineered (49)
    Domains in SCOPe 2.07: d1sj5b1, d1sj5b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sj5A (A:)
    mgsdkihhhhhhmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalame
    kmefprplthdlllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalid
    idsrpsdaiilavktgapifvsdnlvekhsielevnerdlinsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj5A (A:)
    hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthd
    lllsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapi
    fvsdnlvekhsielevnerdlin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sj5B (B:)
    mgsdkihhhhhhmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalame
    kmefprplthdlllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalid
    idsrpsdaiilavktgapifvsdnlvekhsielevnerdlinsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj5B (B:)
    hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaaeghalalamekmefprplthd
    lllsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktg
    apifvsdnlvekhsiel