PDB entry 1sj2

View 1sj2 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis catalase-peroxidase
Class: oxidoreductase
Keywords: HOMODIMER, oxidoreductase
Deposited on 2004-03-02, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxidase/catalase t
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: KATG, RV1908C, MT1959, MTCY180.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj2a1, d1sj2a2
  • Chain 'B':
    Compound: peroxidase/catalase t
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: KATG, RV1908C, MT1959, MTCY180.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj2b1, d1sj2b2
  • Heterogens: HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sj2A (A:)
    mefvpeqhppitetttgaasngcpvvghmkypvegggnqdwwpnrlnlkvlhqnpavadp
    mgaafdyaaevatidvdaltrdieevmttsqpwwpadyghygplfirmawhaagtyrihd
    grggagggmqrfaplnswpdnasldkarrllwpvkkkygkklswadlivfagncalesmg
    fktfgfgfgrvdqwepdevywgkeatwlgderysgkrdlenplaavqmgliyvnpegpng
    npdpmaaavdiretfrrmamndvetaalivgghtfgkthgagpadlvgpepeaapleqmg
    lgwkssygtgtgkdaitsgievvwtntptkwdnsfleilygyeweltkspagawqytakd
    gagagtipdpfggpgrsptmlatdlslrvdpiyeritrrwlehpeeladefakawyklih
    rdmgpvarylgplvpkqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstaw
    aaassfrgsdkrgganggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnik
    vsfadlvvlggcaaiekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrny
    lgkgnplpaeymlldkanlltlsapemtvlvgglrvlganykrlplgvfteasesltndf
    fvnlldmgitwepspaddgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaq
    pkfvqdfvaawdkvmnldrfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj2A (A:)
    ghmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieev
    mttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldk
    arrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeat
    wlgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndveta
    alivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtn
    tptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdls
    lrvdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqtllwqdpvp
    avshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgganggrirlqpqv
    gwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaiekaakaaghni
    tvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkanlltlsape
    mtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspaddgtyqgkdg
    sgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnldrfdvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sj2B (B:)
    mefvpeqhppitetttgaasngcpvvghmkypvegggnqdwwpnrlnlkvlhqnpavadp
    mgaafdyaaevatidvdaltrdieevmttsqpwwpadyghygplfirmawhaagtyrihd
    grggagggmqrfaplnswpdnasldkarrllwpvkkkygkklswadlivfagncalesmg
    fktfgfgfgrvdqwepdevywgkeatwlgderysgkrdlenplaavqmgliyvnpegpng
    npdpmaaavdiretfrrmamndvetaalivgghtfgkthgagpadlvgpepeaapleqmg
    lgwkssygtgtgkdaitsgievvwtntptkwdnsfleilygyeweltkspagawqytakd
    gagagtipdpfggpgrsptmlatdlslrvdpiyeritrrwlehpeeladefakawyklih
    rdmgpvarylgplvpkqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstaw
    aaassfrgsdkrgganggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnik
    vsfadlvvlggcaaiekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrny
    lgkgnplpaeymlldkanlltlsapemtvlvgglrvlganykrlplgvfteasesltndf
    fvnlldmgitwepspaddgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaq
    pkfvqdfvaawdkvmnldrfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj2B (B:)
    ghmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieev
    mttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldk
    arrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeat
    wlgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndveta
    alivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtn
    tptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdls
    lrvdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqtllwqdpvp
    avshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgganggrirlqpqv
    gwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaiekaakaaghni
    tvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkanlltlsape
    mtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspaddgtyqgkdg
    sgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnldrfdvr