PDB entry 1sj1

View 1sj1 on RCSB PDB site
Description: The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus
Class: electron transport
Keywords: thermostability, iron-sulfur cluster, hexammine cobalt(III), ELECTRON TRANSPORT
Deposited on 2004-03-02, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.195
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: FDXA, PF1909
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj1a_
  • Chain 'B':
    Compound: ferredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: FDXA, PF1909
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj1b_
  • Heterogens: NCO, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sj1A (A:)
    awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
    itieea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sj1B (B:)
    awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
    itieea