PDB entry 1siz

View 1siz on RCSB PDB site
Description: Crystal structure of the [Fe3S4]-ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus
Class: electron transport
Keywords: thermostability, iron-sulfur clusters, dimer, ELECTRON TRANSPORT
Deposited on 2004-03-02, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.239
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: FDXA, PF1909
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1siza_
  • Chain 'C':
    Compound: ferredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: FDXA, PF1909
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sizc_
  • Heterogens: 3CO, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sizA (A:)
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sizC (C:)
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea