PDB entry 1siy

View 1siy on RCSB PDB site
Description: NMR structure of mung bean non-specific lipid transfer protein 1
Class: lipid binding protein
Keywords: alpha helix, LIPID BINDING PROTEIN
Deposited on 2004-03-02, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonspecific lipid-transfer protein 1
    Species: Vigna radiata var. radiata [TaxId:3916]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1siya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1siyA (A:)
    mtcgqvqgnlaqcigflqkggvvppscctgvknilnssrttadrravcsclkaaagavrg
    inpnnaealpgkcgvnipykiststncnsin