PDB entry 1six

View 1six on RCSB PDB site
Description: Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP
Class: hydrolase
Keywords: jelly-roll, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, HYDROLASE
Deposited on 2004-03-01, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.122
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DUT, RV2697C, MT2771, MTCY05A6.18C, MB2716C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A552 (20-End)
      • cloning artifact (11-19)
    Domains in SCOPe 2.08: d1sixa1, d1sixa2
  • Heterogens: MG, DUP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1sixA (A:)
mgsshhhhhhssglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapg
rralvrtgvavavpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpa
apivvhrgdriaqllvqrvelvelvevssfdeaglastsrgdgghgssgghasl

    Sequence, based on observed residues (ATOM records): (download) 
    >1sixA (A:)
sglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvav
avpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdri
aqllvqrvelvelvevssfdeaglastsrgdgg