PDB entry 1siv
View 1siv on RCSB PDB site
Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, acid proteinase
Deposited on
1993-08-24, released
1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: siv protease
Species: Simian immunodeficiency virus [TaxId:11723]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1siva_ - Chain 'B':
Compound: siv protease
Species: Simian immunodeficiency virus [TaxId:11723]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1sivb_ - Heterogens: PSI, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1sivA (A:)
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1sivB (B:)
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl