PDB entry 1siv

View 1siv on RCSB PDB site
Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, acid proteinase
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: siv protease
  Species: Simian immunodeficiency virus [TaxId:11723]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07387 (0-98)
  Domains in SCOPe 2.06: d1siva_
• Chain 'B':
  Compound: siv protease
  Species: Simian immunodeficiency virus [TaxId:11723]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07387 (0-98)
  Domains in SCOPe 2.06: d1sivb_
• Heterogens: PSI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sivA (A:)
  pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
  nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sivB (B:)
  pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
  nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl