PDB entry 1siv

View 1siv on RCSB PDB site
Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1siva_
  • Chain 'B':
    Domains in SCOP 1.61: d1sivb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sivA (A:)
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sivB (B:)
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl