PDB entry 1siv

View 1siv on RCSB PDB site
Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, acid proteinase
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1siva_
  • Chain 'B':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sivb_
  • Heterogens: PSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sivA (A:)
    pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sivB (B:)
    pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl