PDB entry 1sip

View 1sip on RCSB PDB site
Description: alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1994-04-13, released 1994-08-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unliganded siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87706 (0-97)
      • conflict (71)
    Domains in SCOPe 2.05: d1sipa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sipA (A:)
    pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nveievlgkrirgtimtgdtpinifgrnlltalgmslnf