PDB entry 1sip

View 1sip on RCSB PDB site
Description: alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase
Deposited on 1994-04-13, released 1994-08-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1sip__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sip_ (-)
    pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nveievlgkrirgtimtgdtpinifgrnlltalgmslnf