PDB entry 1sii

View 1sii on RCSB PDB site
Description: AGAO in covalent complex with the inhibitor NOBA ("4-(2-naphthyloxy)-2-butyn-1-amine")
Class: oxidoreductase
Keywords: CAO, CuAO, COPPER-CONTAINING, AMINE OXIDASE, TPQ, QUINONE, TRIHYDROXYPHENYLALANINE QUINONE, NOBA, 4-(2-naphthyloxy)-2-butyn-1-amine, 4-(aryloxy)-2-butynamine, suicide inhibition, OXIDOREDUCTASE
Deposited on 2004-02-29, released 2004-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.159
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: ATCC8010, IFO12137
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1siia1, d1siia2, d1siia3
  • Heterogens: CU, NA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1siiA (A:)
    pstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrv
    fihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkal
    aarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvv
    skevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewek
    wsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgey
    lvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsgi
    nytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisql
    apglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltrese
    avreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlw
    vtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpim
    pvdtvgfklrpegffdrspvldvpanpsqsgshchgsnwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1siiA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan