PDB entry 1sig

View 1sig on RCSB PDB site
Description: crystal structure of a sigma70 subunit fragment from escherichia coli RNA polymerase
Class: transcription regulation
Keywords: RNA polymerase sigma factor, transcription regulation
Deposited on 1997-02-18, released 1997-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase primary sigma factor
    Species: Escherichia coli [TaxId:83333]
    Gene: rpoD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00579 (4-End)
      • conflict (39)
    Domains in SCOPe 2.06: d1siga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sigA (A:)
    gshmegeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvdpn
    aeedlaptathvgselsqedldddededeedgdddsadddnsidpelarekfaelraqyv
    vtrdtikakgrshataqeeilklsevfkqfrlvpkqfdylvnsmrvmmdrvrtqerlimk
    lcveqckmpkknfitlftgnetsdtwfnaaiamnkpwseklhdvseevhralqklqqiee
    etgltieqvkdinrrmsigeakarrakkemveanlrlvisiakkytnrglqfldliqegn
    iglmkavdkfeyrrgykfstyatwwirqaitrsiadqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sigA (A:)
    megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvddlapt
    athvgselsqedldidpelarekfaelraqyvvtrdtikahataqeeilklsevfkqfrl
    vpkqfdylvnsmrvmmdrvrtqerlimklcveqckmpkknfitlftgnetsdtwfnaaia
    mnkpwseklhdvseevhralqklqqieeetgltieqvkdinrrmsigeakarrakkemve
    anlrlvisiakkytnrglqfldliqegniglmkavdkfeyrrgykfstyatwwirqaitr
    siadq