PDB entry 1si9

View 1si9 on RCSB PDB site
Description: Boiling stable protein isolated from Populus tremula
Class: plant protein
Keywords: stress, heat shock responsive, boiling-soluble, plant protein
Deposited on 2004-02-29, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si9a_
  • Chain 'B':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si9b_
  • Chain 'C':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si9c_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1si9A (A:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si9A (A:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1si9B (B:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si9B (B:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1si9C (C:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si9C (C:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly