PDB entry 1si8

View 1si8 on RCSB PDB site
Description: Crystal structure of E. faecalis catalase
Class: oxidoreductase
Keywords: N-terminal arm; anti-parallel beta-barrel; wrapping region; C-terminal helical region; tetramer; heme group, OXIDOREDUCTASE
Deposited on 2004-02-28, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: katA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si8a_
  • Chain 'B':
    Compound: catalase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: katA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si8b_
  • Chain 'C':
    Compound: catalase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: katA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si8c_
  • Chain 'D':
    Compound: catalase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: katA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si8d_
  • Heterogens: SO4, CL, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1si8A (A:)
    mknqhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgaga
    hgifkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdeg
    nydlvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilms
    drgiplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfh
    iedlhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrn
    penyfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakap
    vnnyqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqa
    nalynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqqahh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si8A (A:)
    qhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgagahgi
    fkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdegnyd
    lvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilmsdrg
    iplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfhied
    lhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrnpen
    yfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakapvnn
    yqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqanal
    ynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1si8B (B:)
    mknqhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgaga
    hgifkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdeg
    nydlvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilms
    drgiplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfh
    iedlhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrn
    penyfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakap
    vnnyqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqa
    nalynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqqahh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si8B (B:)
    qhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgagahgi
    fkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdegnyd
    lvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilmsdrg
    iplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfhied
    lhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrnpen
    yfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakapvnn
    yqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqanal
    ynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1si8C (C:)
    mknqhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgaga
    hgifkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdeg
    nydlvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilms
    drgiplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfh
    iedlhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrn
    penyfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakap
    vnnyqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqa
    nalynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqqahh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si8C (C:)
    qhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgagahgi
    fkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdegnyd
    lvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilmsdrg
    iplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfhied
    lhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrnpen
    yfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakapvnn
    yqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqanal
    ynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1si8D (D:)
    mknqhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgaga
    hgifkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdeg
    nydlvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilms
    drgiplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfh
    iedlhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrn
    penyfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakap
    vnnyqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqa
    nalynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqqahh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si8D (D:)
    qhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgagahgi
    fkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdegnyd
    lvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilmsdrg
    iplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfhied
    lhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrnpen
    yfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakapvnn
    yqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqanal
    ynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqq