PDB entry 1si6

View 1si6 on RCSB PDB site
Description: Crystal structure of cimex nitrophorin complex with CO
Class: transport protein
Keywords: ferrous heme, carbon monoxide, beta sandwich, TRANSPORT PROTEIN
Deposited on 2004-02-27, released 2005-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.206
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius [TaxId:79782]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1si6x_
  • Heterogens: CMO, HEM, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1si6X (X:)
    gsppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpac
    vknfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivt
    sftiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetna
    thakslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatps
    wtdralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si6X (X:)
    ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl