PDB entry 1si5

View 1si5 on RCSB PDB site
Description: Protease-like domain from 2-chain hepatocyte growth factor
Class: hormone/growth factor
Keywords: chymotrypsin homology, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2004-02-27, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: hepatocyte growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14210 (0-233)
      • engineered (109)
    Domains in SCOPe 2.07: d1si5h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1si5H (H:)
    vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh
    grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv
    ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg
    gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiiltykvpqshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si5H (H:)
    vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh
    grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv
    ygwgytglinydgllrvahlyimgnekcsqlneseicagaekigsgpcegdyggplvceq
    hkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiiltykvpqs