PDB entry 1si3
View 1si3 on RCSB PDB site
Description: Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex
Class: gene regulation/RNA
Keywords: protein-RNA complex, RNA interference, double helix, overhang, gene regulation/RNA complex
Deposited on
2004-02-27, released
2004-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.247
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Eukaryotic translation initiation factor 2C 1
Species: Homo sapiens [TaxId:9606]
Gene: EIF2C1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9UL18 (4-End)
- cloning artifact (3)
- modified residue (11)
- modified residue (52)
Domains in SCOPe 2.06: d1si3a1, d1si3a2 - Chain 'B':
Compound: 5'-r(*cp*gp*up*gp*ap*cp*up*cp*u)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1si3A (A:)
gshmaqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvc
nvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylple
vcnivagqrcikkltdnqtstmikatars
Sequence, based on observed residues (ATOM records): (download)
>1si3A (A:)
maqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvt
rrpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr
- Chain 'B':
No sequence available.