PDB entry 1si3

View 1si3 on RCSB PDB site
Description: Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex
Class: gene regulation/RNA
Keywords: protein-RNA complex, RNA interference, double helix, overhang, gene regulation/RNA complex
Deposited on 2004-02-27, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.247
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 2C 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2C1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UL18 (4-End)
      • cloning artifact (3)
      • modified residue (11)
      • modified residue (52)
    Domains in SCOPe 2.08: d1si3a1, d1si3a2
  • Chain 'B':
    Compound: 5'-r(*cp*gp*up*gp*ap*cp*up*cp*u)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1si3A (A:)
    gshmaqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvc
    nvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylple
    vcnivagqrcikkltdnqtstmikatars
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si3A (A:)
    maqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvt
    rrpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr
    

  • Chain 'B':
    No sequence available.