PDB entry 1si2

View 1si2 on RCSB PDB site
Description: Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex of deoxynucleotide overhang
Class: gene regulation/RNA/DNA
Keywords: protein-RNA complex, RNA interference, double helix, overhang, gene regulation/RNA/DNA complex
Deposited on 2004-02-26, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 2C 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2C1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UL18 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.08: d1si2a1, d1si2a2
  • Chain 'B':
    Compound: 5'-r(*cp*gp*up*gp*ap*cp*u)-d(p*cp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1si2A (A:)
gshmaqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvc
nvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylple
vcnivagqrcikkltdnqtstmikatars

    Sequence, based on observed residues (ATOM records): (download) 
    >1si2A (A:)
maqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvt
rrpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr

  • Chain 'B':
    No sequence available.