PDB entry 1si0

View 1si0 on RCSB PDB site
Description: Crystal Structure of Mannheimia haemolytica Ferric iron-Binding Protein A in a closed conformation
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2004-02-26, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.16
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron binding protein FbpA
    Species: Mannheimia haemolytica [TaxId:75985]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1si0a_
  • Heterogens: FE, CO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1si0A (A:)
    anevnvysyrqpyliepmlknfekdtgikvniifadkglvdrvkqegelspadvlltvdi
    srvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfd
    yldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrd
    qvkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhs
    pnkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakn
    yeaalklvdevkfddfsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1si0A (A:)
    anevnvysyrqpyliepmlknfekdtgikvniifadkglvdrvkqegelspadvlltvdi
    srvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfd
    yldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrd
    qvkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhs
    pnkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakn
    yeaalklvdevkfddf