PDB entry 1shz

View 1shz on RCSB PDB site
Description: Crystal Structure of the p115RhoGEF rgRGS Domain in A Complex with Galpha(13):Galpha(i1) Chimera
Class: signaling protein
Keywords: signal transduction, protein complex, signaling protein
Deposited on 2004-02-26, released 2005-01-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine Nucleotide-Binding Protein Galpha(13):Galpha(i1) Chimera
    Species: , [TaxId:10090,10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1shza1, d1shza2
  • Chain 'C':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1shzc_
  • Chain 'D':
    Compound: Guanine Nucleotide-Binding Protein Galpha(13):Galpha(i1) Chimera
    Species: , [TaxId:10090,10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1shzd1, d1shzd2
  • Chain 'F':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1shzf_
  • Heterogens: MG, ALF, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shzA (A:)
    nlredgekaarevkllllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgm
    rvlvdareklhipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalweds
    giqnaydrrrefqlgesvkyfldnldklgvpdyipsqqdillarrptkgihethftfkdl
    hfkmfdvggqrserkkwfecfegvtaiifcvalsdydqvlmedrqtnrmhesmklfdsic
    nnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrk
    dtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shzA (A:)
    arevkllllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgmrvlvdarek
    lhipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalwedsgiqnaydrr
    refqlgesvkyfldnldklgvpdyipsqqdillarrptkgihethftfkdlhfkmfdvgg
    qrserkkwfecfegvtaiifcvalsdydqvlmedrqtnrmhesmklfdsicnnkwftdts
    iilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythf
    tcatdtknvqfvfdavtdviiknnlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1shzC (C:)
    gaaspgpsrpglvpvsiigaededfeneletnseeqnsqfqsleqvkrrpahlmallqhv
    alqfepgpllcclhadmlgslgpkeakkafldfyhsflektavlrvpvppnvafeldrtr
    adlisedvqrrfvqevvqsqqvavgrqledfrskrlmgmtpweqelaqleawvgrdrasy
    earerhvaerllmhleemqhtistdeeksaavvnaiglymrhlgvrtksgdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shzC (C:)
    pglvpvsiigaededfeneletsqfqsleqvkrrpahlmallqhvalqfepgpllcclha
    dmlgskkafldfyhsflektavlrvpvppnvafeldvqrrfvqevvqsqqvavgrqledf
    rskrlmgmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaa
    vvnaiglymrhlgvrt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1shzD (D:)
    nlredgekaarevkllllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgm
    rvlvdareklhipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalweds
    giqnaydrrrefqlgesvkyfldnldklgvpdyipsqqdillarrptkgihethftfkdl
    hfkmfdvggqrserkkwfecfegvtaiifcvalsdydqvlmedrqtnrmhesmklfdsic
    nnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrk
    dtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shzD (D:)
    aarevkllllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgmrvlvdare
    klhipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalwedsgiqnaydr
    rrefqlgesvkyfldnldklgvpdyipsqqdillarrptkgihethftfkdlhfkmfdvg
    gqrserkkwfecfegvtaiifcvalsdydqvlmedrqtnrmhesmklfdsicnnkwftdt
    siilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiyth
    ftcatdtknvqfvfdavtdviiknnlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1shzF (F:)
    gaaspgpsrpglvpvsiigaededfeneletnseeqnsqfqsleqvkrrpahlmallqhv
    alqfepgpllcclhadmlgslgpkeakkafldfyhsflektavlrvpvppnvafeldrtr
    adlisedvqrrfvqevvqsqqvavgrqledfrskrlmgmtpweqelaqleawvgrdrasy
    earerhvaerllmhleemqhtistdeeksaavvnaiglymrhlgvrtksgdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shzF (F:)
    glvpvsiigaededfenesqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlg
    pkeakkafldfyhsflektavlrvpvppnvafelvqrrfvqevvqsqqvavgrqledfrs
    krlmgmtpweqelaqleawsyearerhvaerllmhleemqhtistdeeksaavvnaigly
    mrhlgvrt