PDB entry 1shy

View 1shy on RCSB PDB site
Description: The Crystal Structure of HGF beta-chain in Complex with the Sema Domain of the Met Receptor.
Deposited on 2004-02-26, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 3.22 Å
R-factor: 0.212
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shyA (A:)
    vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh
    grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv
    ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg
    gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiiltykvpqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shyA (A:)
    vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh
    grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv
    ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg
    gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shyB (B:)
    eckealaksemnvnmkyqlpnftaetpiqnvilhehhiflgatnyiyvlneedlqkvaey
    ktgpvlehpdcfpcqdcsskanlsggvwkdninmalvvdtyyddqliscgsvnrgtcqrh
    vfphnhtadiqsevhcifspqieepsqcpdcvvsalgakvlssvkdrfinffvgntinss
    yfpdhplhsisvrrlketkdgfmfltdqsyidvlpefrdsypikyvhafesnnfiyfltv
    qretldaqtfhtriirfcsinsglhsymempleciltelvprgstkkevfnilqaayvsk
    pgaqlarqigaslnddilfgvfaqskpdsaepmdrsamcafpikyvndffnkivnknnvr
    clqhfygpnhehcfnrtllrnssgcearrdeyrtefttalqrvdlfmgqfsevlltsist
    fikgdltianlgtsegrfmqvvvsrsgpstphvnflldshpvspevivehtlnqngytlv
    itgkkitkiplnglgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqiclpa
    iykhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shyB (B:)
    kyqlpnftaetpiqnvilhehhiflgatnyiyvlneedlqkvaeyktgpvlehpdcfpcq
    dcsskanlsggvwkdninmalvvdtyyddqliscgsvnrgtcqrhvfphnhtadiqsevh
    cifspqieepsqcpdcvvsalgakvlssvkdrfinffvgntinssyfpdhplhsisvrrl
    ketkdgfmfltdqsyidvlpefrdsypikyvhafesnnfiyfltvqretldaqtfhtrii
    rfcsinsglhsymempleciltkevfnilqaayvskpgaqlarqigaslnddilfgvfaq
    skpdsaepmdrsamcafpikyvndffnkinvrclqhfygpnhehcfnrdeyrtefttalq
    rvdlfmgqfsevlltsistfikgdltianlgtsegrfmqvvvsrsgpstphvnflldshp
    vspevivehtlnqngytlvitgkkitkiplnglgcrhfqscsqclsappfvqcgwchdkc
    vrseeclsgtwtqqiclpa