PDB entry 1sht

View 1sht on RCSB PDB site
Description: Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor
Deposited on 2004-02-26, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.151
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.67: d1shtx_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1shtX (X:)
    gscrrafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilplt
    gdrgkiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvp
    syaekeakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shtX (X:)
    rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
    kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
    keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqs