PDB entry 1sht

View 1sht on RCSB PDB site
Description: Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor
Class: membrane protein
Keywords: Rossmann fold, MEMBRANE PROTEIN
Deposited on 2004-02-26, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.151
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Anthrax toxin receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR2, CMG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1shtx_
  • Heterogens: ACT, MG, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1shtX (X:)
    gscrrafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilplt
    gdrgkiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvp
    syaekeakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shtX (X:)
    rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
    kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
    keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqs