PDB entry 1shq

View 1shq on RCSB PDB site
Description: Crystal structure of shrimp alkaline phosphatase with magnesium in M3
Class: hydrolase
Keywords: alkaline phosphatase, hydrolase, phosphomonoester, cold-active, shrimp, metal triad, magnesium, metal exchange, beta sheet
Deposited on 2004-02-26, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Pandalus borealis [TaxId:6703]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BHT8 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1shqa1, d1shqa2
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Pandalus borealis [TaxId:6703]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BHT8 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1shqb1, d1shqb2
  • Heterogens: NAG, ZN, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shqA (A:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shqA (A:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shqB (B:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shqB (B:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd