PDB entry 1shp

View 1shp on RCSB PDB site
Description: the nmr solution structure of a kunitz-type proteinase inhibitor from the sea anemone stichodactyla helianthus
Class: proteinase inhibitor(trypsin)
Keywords: proteinase inhibitor(trypsin)
Deposited on 1992-11-17, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsin inhibitor
  Species: Stichodactyla helianthus [TaxId:6123]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31713 (0-54)
  Domains in SCOPe 2.07: d1shpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1shpA (A:)
  sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra