PDB entry 1shp

View 1shp on RCSB PDB site
Description: the nmr solution structure of a kunitz-type proteinase inhibitor from the sea anemone stichodactyla helianthus
Deposited on 1992-11-17, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1shp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1shp_ (-)
    sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra