PDB entry 1shn

View 1shn on RCSB PDB site
Description: Crystal structure of shrimp alkaline phosphatase with phosphate bound
Class: hydrolase
Keywords: alkaline phosphatase, hydrolase, phosphomonoester, phosphate, cold-active, shrimp, metal triad, zinc triad, beta sheet
Deposited on 2004-02-26, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Pandalus borealis [TaxId:6703]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BHT8 (3-End)
      • cloning artifact (0-2)
      • conflict (183)
      • conflict (354)
    Domains in SCOPe 2.07: d1shna1, d1shna2
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Pandalus borealis [TaxId:6703]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BHT8 (3-End)
      • cloning artifact (0-2)
      • conflict (183)
      • conflict (354)
    Domains in SCOPe 2.07: d1shnb1, d1shnb2
  • Heterogens: NAG, ZN, PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shnA (A:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shnA (A:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shnB (B:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shnB (B:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd