PDB entry 1shm

View 1shm on RCSB PDB site
Description: Convergent solutions to VHH domain stabilization from natural and in vitro evolution
Class: immune system
Keywords: Heavy Chain Variable Domain, VHH Domain, Immunoglobulin, IMMUNE SYSTEM
Deposited on 2004-02-26, released 2005-03-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody rig
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SHM (Start-126)
    Domains in SCOPe 2.02: d1shma_
  • Chain 'B':
    Compound: antibody rig
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SHM (Start-126)
    Domains in SCOPe 2.02: d1shmb_
  • Chain 'D':
    Compound: antibody rig
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SHM (Start-126)
    Domains in SCOPe 2.02: d1shmd_
  • Chain 'E':
    Compound: antibody rig
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SHM (Start-126)
    Domains in SCOPe 2.02: d1shme_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shmA (A:)
    dvqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shmA (A:)
    vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
    ssvrgrftisrdnakktvylqmnslkpedtavytcgagrireswvtwwgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shmB (B:)
    dvqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shmB (B:)
    vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
    ssvrgrftisrdnakktvylqmnslkpedtavytcgagrieswvtwwgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1shmD (D:)
    dvqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shmD (D:)
    vqlqesggglvqaggslrlscaasstydmgwfrqapgkeresvaainwgsagtyyassvr
    grftisrdnakktvylqmnslkpedtavytcgagrieswvtwwgqgtqvtvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1shmE (E:)
    dvqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shmE (E:)
    vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
    ssvrgrftisrdnakktvylqmnslkpedtavytcgagrireswvtwwgqgtqvtvss