PDB entry 1shl

View 1shl on RCSB PDB site
Description: caspase-7 in complex with fica allosteric inhibitor
Class: hydrolase
Keywords: caspase, protease, cysteine protease, allosteric, central-cavity, dimer interface, inhibitor, HYDROLASE
Deposited on 2004-02-25, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-7
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7, MCH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1shla_
  • Chain 'B':
    Compound: caspase-7
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7, MCH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1shlb_
  • Heterogens: FXN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shlA (A:)
    tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
    akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
    kpklffiqacrgteladgiqadsrykipveadflfaystvpgyyswrspgrgswfvqalc
    sileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsqqlh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shlA (A:)
    tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
    akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
    kpklffiqacipveadflfaystvrgswfvqalcsileehgkdleimqiltrvndrvarh
    fqipcvvsmltkelyfsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shlB (B:)
    tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
    akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
    kpklffiqacrgteladgiqadsrykipveadflfaystvpgyyswrspgrgswfvqalc
    sileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsqqlh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shlB (B:)
    tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
    akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
    kpklffiqacrgipveadflfaystvpgswfvqalcsileehgkdleimqiltrvndrva
    rhfqipcvvsmltkelyfsq