PDB entry 1shj

View 1shj on RCSB PDB site
Description: Caspase-7 in complex with DICA allosteric inhibitor
Class: hydrolase
Keywords: cysteine protease, allosteric, inhibitor, central cavity, HYDROLASE
Deposited on 2004-02-25, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.246
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-7
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7, MCH3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55210 (Start-253)
      • engineered (119)
    Domains in SCOPe 2.07: d1shja_
  • Chain 'B':
    Compound: caspase-7
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7, MCH3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55210 (Start-253)
      • engineered (119)
    Domains in SCOPe 2.07: d1shjb_
  • Heterogens: SO4, NXN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shjA (A:)
    ttrdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvi
    vyndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrga
    rcktllekpklffiqacrgtelddgiqadsgpindtdanprykipveadflfaystvpgy
    yswrspgrgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekkqip
    cvvsmltkelyfsqqlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shjA (A:)
    tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
    akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktlle
    kpklffiqacrgteprykipveadflfaystvrgswfvqalcsileehgkdleimqiltr
    vndrvarhfkkqipcvvsmltkelyfsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shjB (B:)
    ttrdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvi
    vyndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrga
    rcktllekpklffiqacrgtelddgiqadsgpindtdanprykipveadflfaystvpgy
    yswrspgrgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekkqip
    cvvsmltkelyfsqqlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shjB (B:)
    vptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndc
    scakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktl
    lekpklffiqacrgprykipveadflfaystvpgswfvqalcsileehgkdleimqiltr
    vndrvarhfeskqipcvvsmltkelyfsq