PDB entry 1shd

View 1shd on RCSB PDB site
Description: peptide inhibitors of src sh3-sh2-phosphoprotein interactions
Class: complex(transferase/peptide)
Keywords: COMPLEX(TRANSFERASE-PEPTIDE), COMPLEX(TRANSFERASE-PEPTIDE) complex
Deposited on 1994-11-10, released 1995-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-src tyrosine kinase sh2 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1shda_
  • Chain 'B':
    Compound: trka receptor
    Database cross-references and differences (RAF-indexed):
    • PDB 1SHD
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shdA (A:)
    mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
    khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shdA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvreseayclsvsdfdnakglnvkhykir
    kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'B':
    No sequence available.