PDB entry 1shc

View 1shc on RCSB PDB site
Description: shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
Class: complex (signal transduction/peptide)
Keywords: complex (signal transduction/peptide), phosphotyrosine binding domain (ptb)
Deposited on 1996-03-27, released 1997-05-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shc
    Species: Homo sapiens [TaxId:9606]
    Gene: PTB DOMAIN OF SHC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29353 (0-194)
      • conflict (3)
    Domains in SCOPe 2.01: d1shca_
  • Chain 'B':
    Compound: trka receptor phosphopeptide
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04629 (0-11)
      • modified residue (7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1shcA (A:)
    gshmgqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfn
    trtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstssln
    lmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvis
    tigqafelrfkqylr
    

  • Chain 'B':
    No sequence available.