PDB entry 1shc

View 1shc on RCSB PDB site
Description: shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
Deposited on 1996-03-27, released 1997-05-15
The last revision prior to the SCOP 1.69 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1shca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1shcA (A:)
gshmgqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfn
trtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstssln
lmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvis
tigqafelrfkqylr