PDB entry 1sha

View 1sha on RCSB PDB site
Description: crystal structure of the phosphotyrosine recognition domain sh2 of v-src complexed with tyrosine-phosphorylated peptides
Deposited on 1992-08-18, released 1993-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1shaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1shaA (A:)
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

    Sequence, based on observed residues (ATOM records): (download) 
    >1shaA (A:)
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt