PDB entry 1sh8

View 1sh8 on RCSB PDB site
Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA5026 from Pseudomonas aeruginosa, Probable Thioesterase
Class: structural genomics, unknown function
Keywords: Structural Genomics, Pseudomonas aeruginosa, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-02-25, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA5026
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUE3 (2-151)
      • cloning artifact (1)
      • cloning artifact (152-153)
    Domains in SCOPe 2.07: d1sh8a1, d1sh8a2, d1sh8a3
  • Chain 'B':
    Compound: hypothetical protein PA5026
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUE3 (2-End)
      • cloning artifact (1)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1sh8b1, d1sh8b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sh8A (A:)
    ghmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftl
    aelpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergk
    aeyslelqltdeqgevvaesaalyqlrsharpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sh8A (A:)
    hmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftla
    elpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergka
    eyslelqltdeqgevvaesaalyqlrsharpgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sh8B (B:)
    ghmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftl
    aelpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergk
    aeyslelqltdeqgevvaesaalyqlrsharpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sh8B (B:)
    ghmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftl
    aelpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergk
    aeyslelqltdeqgevvaesaalyqlrsh