PDB entry 1sh5

View 1sh5 on RCSB PDB site
Description: Crystal structure of actin-binding domain of mouse plectin
Class: structural protein
Keywords: plectin; actin-binding domain; calponin-homology domain; structural protein
Deposited on 2004-02-25, released 2004-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plectin 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QXS1 (6-End)
      • cloning artifact (5)
    Domains in SCOPe 2.06: d1sh5a1, d1sh5a2, d1sh5a3
  • Chain 'B':
    Compound: Plectin 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QXS1 (6-End)
      • cloning artifact (5)
    Domains in SCOPe 2.06: d1sh5b1, d1sh5b2, d1sh5b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sh5A (A:)
    gshmefderdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgd
    slprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqi
    sdiqvsgqsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlid
    mnkvyrqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp
    gaqef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sh5A (A:)
    fderdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgdslpre
    kgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqv
    sgqsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlidmnkvy
    rqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sh5B (B:)
    gshmefderdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgd
    slprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqi
    sdiqvsgqsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlid
    mnkvyrqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp
    gaqef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sh5B (B:)
    fderdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgdslpre
    kgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqv
    sgqsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlidmnkvy
    rqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp